PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G08680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 329aa    MW: 35926.6 Da    PI: 9.1528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G08680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-1794140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  OBART07G08680.1  94 KGGWTREEDEVLRQIVQHHGDRKWAEIAKSLP-GRIGKQCRERWTNHL 140
                      688*****************************.************996 PP

2Myb_DNA-binding47.15.6e-15146190147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g WT+eE  +l++a++ +G++ W++Iar ++ gR+++ +k+ w++ 
  OBART07G08680.1 146 KGIWTEEENRKLIRAHQTYGNR-WSAIARSLP-GRSENTVKNCWNTT 190
                      678*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.8889144IPR017930Myb domain
SuperFamilySSF466891.24E-2991187IPR009057Homeodomain-like
SMARTSM007171.3E-1593142IPR001005SANT/Myb domain
PfamPF002496.7E-1694140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2596145IPR009057Homeodomain-like
CDDcd001671.93E-1597140No hitNo description
SMARTSM007171.2E-15145193IPR001005SANT/Myb domain
PROSITE profilePS5129414.682145195IPR017930Myb domain
PfamPF002492.3E-13146189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-21146192IPR009057Homeodomain-like
CDDcd001674.00E-13149191No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MATDRMPDSH FMASSNGGAC YQNTHGTPIT MGVPNLGCLI ASIGIAPSSS LMPERGLATA  60
NYNLVANFPE DAAVVPQQQQ LQAASSNSNS RLIKGGWTRE EDEVLRQIVQ HHGDRKWAEI  120
AKSLPGRIGK QCRERWTNHL HPDIKKGIWT EEENRKLIRA HQTYGNRWSA IARSLPGRSE  180
NTVKNCWNTT KRSLNSKHRL RKKNSEQAVP RQPSLLEEYI RSCQHPLPNE TAPPASFDIG  240
GYGTGGTIGA SPTPPTVHAL GGSTPLGLVM FLDLLNQATP HPPQPDLNLL NITPVVPHLN  300
TSGYCLQLDA RGNCSMASCR CNPTGSTPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C2e-385819225156MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-385819225156MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.11e-164PREDICTED: transcription factor RAX1-like
TrEMBLA0A0D3GP410.0A0A0D3GP41_9ORYZ; Uncharacterized protein
STRINGBGIOSGA025449-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-47myb domain protein 98